Pfam domain
Pfam family: Ribosomal_L7Ae (PF01248.25)
Uniprot AC: P14120
RecName: 60S ribosomal protein L30
Begin-End: 9-102
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVY
YFQGGNNELGTAVGKLFRVGVVSILEAGDSDILT
Structures of the domain P14120 9-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1t0k X-ray 3.24 B 10-101 None
6em5 X-ray 4.3 c 10-101 None


© NPIDB team 2003 - 2019

text