Pfam domain
Pfam family: Ribosomal_L11_N (PF03946.13)
Uniprot AC: P14122
RecName: 50S ribosomal protein L11
Begin-End: 5-62
Organism: Haloarcula marismortui
Interaction Mode:   

Sequence:
IEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSF
Structures of the domain P14122 5-62
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2qa4 X-ray 3 I 5-62 None


© NPIDB team 2003 - 2019

text