Pfam domain
Pfam family: Ribosomal_L11 (PF00298.18)
Uniprot AC: P14122
RecName: 50S ribosomal protein L11
Begin-End: 67-135
Organism: Haloarcula marismortui
Interaction Mode:   

Sequence:
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVG
TCTSLGVTI
Structures of the domain P14122 67-135
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1vq6 X-ray 2.7 I 72-139 None
1yit X-ray 2.8 I 67-134 None
1yjw X-ray 2.9 I 67-134 None
1vql X-ray 2.3 I 72-139 None
1yhq X-ray 2.4 I 67-134 None
1vqk X-ray 2.3 I 72-139 None
1vqm X-ray 2.3 I 72-139 None
3cc4 X-ray 2.7 I 67-134 None
1yjn X-ray 3 I 67-134 None
3ccr X-ray 3 I 67-134 None
1vq8 X-ray 2.2 I 72-139 None
1yj9 X-ray 2.9 I 67-134 None
3ccv X-ray 2.9 I 67-134 None
1vq9 X-ray 2.4 I 72-139 None
1vq5 X-ray 2.6 I 72-139 None
2otl X-ray 2.7 I 72-139 None
3ccj X-ray 3.3 I 67-134 None
1yij X-ray 2.6 I 67-134 None
1s72 X-ray 2.4 I 72-139 None
1vqo X-ray 2.2 I 72-139 None
1vqp X-ray 2.25 I 72-139 None
1vqn X-ray 2.4 I 72-139 None
1vq4 X-ray 2.7 I 72-139 None
1yi2 X-ray 2.65 I 67-134 None
3cce X-ray 2.75 I 67-134 None
3cc7 X-ray 2.7 I 67-134 None
3cc2 X-ray 2.4 I 67-134 None
2otj X-ray 2.9 I 72-139 None
3cma X-ray 2.8 I 67-134 None
3cme X-ray 2.95 I 67-134 None
3g4s X-ray 3.2 I 67-134 None
3ccq X-ray 2.9 I 67-134 None
2qex X-ray 2.9 I 72-139 None
3ccm X-ray 2.55 I 67-134 None
3i55 X-ray 3.11 I 67-134 None
1vq7 X-ray 2.5 I 72-139 None
3ccu X-ray 2.8 I 67-134 None
3i56 X-ray 2.9 I 67-134 None
3g71 X-ray 2.85 I 67-134 None
3g6e X-ray 2.7 I 67-134 None
3cd6 X-ray 2.75 I 67-134 None
3ccl X-ray 2.9 I 67-134 None
3ccs X-ray 2.95 I 67-134 None


© NPIDB team 2003 - 2019

text