Pfam domain
Pfam family: Ribosomal_L3 (PF00297.21)
Uniprot AC: P14126
RecName: 60S ribosomal protein L3
Begin-End: 12-366
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKRE
VVEAVTVVDTPPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFT
KYSAKYAQDGAGIERELARIKKYASVVRVLVHTQIRKTPLAQKKAHLAEIQLNGGSISEK
VDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRKTHRGLRKVAC
IGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGF
VHYGEIKNDFIMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFG
Structures of the domain P14126 12-366
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 B 12-269 None
6em5 X-ray 4.3 B 12-265 None


© NPIDB team 2003 - 2019

text