Pfam domain
Pfam family: Topoisom_bac (PF01131.19)
Uniprot AC: P14294
RecName: DNA topoisomerase 3
Begin-End: 153-593
Organism: Escherichia coli
Interaction Mode:   

Sequence:
SEFVPLCVSALARARADWLYGINMTRAYTILGRNAGYQGVLSVGRVQTPVLGLVVRRDEE
IENFVAKDFFEVKAHIVTPADERFTAIWQPSEACEPYQDEEGRLLHRPLAEHVVNRISGQ
PAIVTSYNDKRESESAPLPFSLSALQIEAAKRFGLSAQNVLDICQKLYETHKLITYPRSD
CRYLPEEHFAGRHAVMNAISVHAPDLLPQPVVDPDIRNRCWDDKKVDAHHAIIPTARSSA
INLTENEAKVYNLIARQYLMQFCPDAVFRKCVIELDIAKGKFVAKARFLAEAGWRTLLGS
KERDEENDGTPLPVVAKGDELLCEKGEVVERQTQPPRHFTDATLLSAMTGIARFVQDKDL
KKILRATDGLGTEATRAGIIELLFKRGFLTKKGRYIHSTDAGKALFHSLPEMATRPDMTA
HWESVLTQISEKQCRYQDFMQ
Structures of the domain P14294 153-593
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1i7d X-ray 2.05 A 158-593 None
2o5c X-ray 2.35 A 158-593 None
2o5c X-ray 2.35 B 158-593 None
2o5e X-ray 2.5 A 158-593 None
2o5e X-ray 2.5 B 158-593 None
2o19 X-ray 2.45 A 158-593 None
2o19 X-ray 2.45 B 158-593 None
2o54 X-ray 2.5 A 158-593 None
2o54 X-ray 2.5 B 158-593 None
2o59 X-ray 2.5 A 158-593 None
2o59 X-ray 2.5 B 158-593 None


© NPIDB team 2003 - 2019

text