Pfam domain
Pfam family: rve (PF00665.25)
Uniprot AC: P14350
RecName: Pro-Pol polyprotein
Begin-End: 869-982
Organism: Human spumaretrovirus
Interaction Mode:  H-Bb H-Mj H-Mn L-Mj L-Mn 

Sequence:
PQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIA
IPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDIKRLL
Structures of the domain P14350 869-982
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3l2w X-ray 3.2 A 120-229  H-Bb H-Mj H-Mn 
3l2w X-ray 3.2 B 120-229 None
3os0 X-ray 2.81 A 120-229  H-Bb H-Mj H-Mn 
3os0 X-ray 2.81 B 120-229 None
3oyi X-ray 2.72 B 120-229 None
3oyi X-ray 2.72 A 120-229  H-Bb H-Mj H-Mn 
4e7k X-ray 3.02 A 120-229  H-Bb H-Mj H-Mn 
4e7k X-ray 3.02 B 120-229 None
3l2u X-ray 3.15 B 120-229 None
3l2u X-ray 3.15 A 120-229  H-Bb H-Mj H-Mn 
3oyn X-ray 2.68 B 120-229 None
3oyn X-ray 2.68 A 120-229  H-Bb H-Mj H-Mn 
3oyd X-ray 2.54 B 120-229 None
3oyd X-ray 2.54 A 120-229  H-Bb H-Mj H-Mn 
3oy9 X-ray 2.55 B 120-229 None
3oy9 X-ray 2.55 A 120-229  H-Bb H-Mj H-Mn 
3l2v X-ray 3.2 B 120-229 None
3l2v X-ray 3.2 A 120-229  H-Bb H-Mj H-Mn 
3oym X-ray 2.02 B 120-229 None
3oym X-ray 2.02 A 120-229  H-Bb H-Mj H-Mn 
3os2 X-ray 3.32 B 120-229 None
3os2 X-ray 3.32 A 120-229  H-Bb H-Mj H-Mn 
3l2q X-ray 3.25 B 120-229 None
3l2q X-ray 3.25 A 120-229  H-Bb H-Mj H-Mn 
3os1 X-ray 2.97 A 120-229  H-Bb H-Mj H-Mn 
3os1 X-ray 2.97 B 120-229 None
3l2r X-ray 2.88 A 120-229  H-Bb H-Mj H-Mn 
3l2r X-ray 2.88 B 120-229 None
3oyc X-ray 2.66 A 120-229  H-Bb H-Mj H-Mn 
3oyc X-ray 2.66 B 120-229 None
3oyj X-ray 2.68 A 120-229  H-Bb H-Mj H-Mn 
3oyj X-ray 2.68 B 120-229 None
3oyb X-ray 2.54 A 120-229  H-Bb H-Mj H-Mn 
3oyb X-ray 2.54 B 120-229 None
3oyh X-ray 2.74 B 120-229 None
3oyh X-ray 2.74 A 120-229  H-Bb H-Mj H-Mn 
3oye X-ray 2.74 A 120-229  H-Bb H-Mj H-Mn 
3oye X-ray 2.74 B 120-229 None
3oyl X-ray 2.54 B 120-229 None
3oyl X-ray 2.54 A 120-229  H-Bb H-Mj H-Mn 
3oyg X-ray 2.56 B 120-229 None
3oyg X-ray 2.56 A 120-229  H-Bb H-Mj H-Mn 
3oyk X-ray 2.72 A 120-229  H-Bb H-Mj H-Mn 
3oyk X-ray 2.72 B 120-229 None
3oyf X-ray 2.51 A 120-229  H-Bb H-Mj H-Mn 
3oyf X-ray 2.51 B 120-229 None
3oya X-ray 2.65 A 120-229  H-Bb H-Mj H-Mn 
3oya X-ray 2.65 B 120-229 None
3s3n X-ray 2.49 B 120-229 None
3s3n X-ray 2.49 A 120-229  H-Bb H-Mj H-Mn 
3s3o X-ray 2.55 B 120-229 None
3s3o X-ray 2.55 A 120-229  H-Bb H-Mj H-Mn 
3s3m X-ray 2.49 A 120-229  H-Bb H-Mj H-Mn 
3s3m X-ray 2.49 B 120-229 None
4e7j X-ray 3.15 B 120-229 None
4e7j X-ray 3.15 A 120-229  H-Bb H-Mj H-Mn 
4e7i X-ray 2.53 A 120-229  H-Bb H-Mj H-Mn 
4e7i X-ray 2.53 B 120-229 None
4e7h X-ray 2.57 B 120-229 None
4e7h X-ray 2.57 A 120-229  H-Bb H-Mj H-Mn 
4e7l X-ray 3 A 120-229  H-Bb H-Mj H-Mn 
4e7l X-ray 3 B 120-229 None
4bac X-ray 3.263 A 120-229  H-Bb L-Mj L-Mn 
4bac X-ray 3.263 B 120-229 None
4bdz X-ray 2.85 B 120-229 None
4bdz X-ray 2.85 A 120-229  H-Bb H-Mj H-Mn 
4ikf X-ray 3.4 A 120-229  H-Bb H-Mj H-Mn 
4ikf X-ray 3.4 B 120-229 None
5mma X-ray 2.55 A 120-229  H-Bb H-Mj H-Mn 
5mma X-ray 2.55 B 120-229 None
5mmb X-ray 2.77 A 120-229  H-Bb H-Mj H-Mn 
5mmb X-ray 2.77 B 120-229 None


© NPIDB team 2003 - 2019

text