Pfam domain
Pfam family: rve (PF00665.25)
Uniprot AC: P14350
RecName: Pro-Pol polyprotein
Begin-End: 872-958
Organism: Human spumaretrovirus
Interaction Mode:   

Sequence:
PFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPK
VIHSDQGAAFTSSTFAEWAKERGIHLE
Structures of the domain P14350 872-958
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rny X-ray 3.9 L 122-224 None
6rny X-ray 3.9 P 120-209 None


© NPIDB team 2003 - 2021

text