Pfam domain
Pfam family: TaqI_C (PF12950.6)
Uniprot AC: P14385
RecName: Modification methylase TaqI
Begin-End: 290-405
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
VPVLTGRNLKPGWVDYEKNHSGLWMPKERAKELRDFYATPHLVVAHTKGTRVVAAWDERA
YPWREEFHLLPKEGVRLDPSSLVQWLNSEAMQKHVRTLYRDFVPHLTLRMLERLPV
Structures of the domain P14385 290-405
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ibs X-ray 2.4 A 291-405 None
2ibs X-ray 2.4 D 291-405 None
2ih4 X-ray 2.1 A 291-405 None
2ih4 X-ray 2.1 D 291-405 None
2np7 X-ray 1.9 A 291-405 None
2ih5 X-ray 1.8 A 291-405 None
2ibt X-ray 1.7 A 291-405 None
2ibt X-ray 1.7 D 291-405 None
2ih2 X-ray 1.61 A 291-405 None
2ih2 X-ray 1.61 D 291-405 None
2np6 X-ray 2.1 A 291-405 None
2np6 X-ray 2.1 D 291-405 None
1g38 X-ray 2 D 291-405 None
1g38 X-ray 2 A 291-405 None


© NPIDB team 2003 - 2019

text