Pfam domain
Pfam family: SRP_SPB (PF02978.18)
Uniprot AC: P14576
RecName: Signal recognition particle 54 kDa protein
Begin-End: 326-431
Organism: Mus musculus
Interaction Mode:   

Sequence:
QFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQ
ELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMV
Structures of the domain P14576 326-431
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ry1 X-ray 12 W 326-431 None


© NPIDB team 2003 - 2019

text