Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P14678
RecName: Small nuclear ribonucleoprotein-associated proteins B and B'
Begin-End: 7-82
Organism: Homo sapiens
Interaction Mode:   

Sequence:
SKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRV
LGLVLLRGENLVSMTV
Structures of the domain P14678 7-82
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3pgw X-ray 4.4 B 9-81 None
3pgw X-ray 4.4 Q 9-81 None
4pjo X-ray 3.3 p 9-81 None
4pjo X-ray 3.3 P 9-81 None
4pjo X-ray 3.3 b 9-81 None
4pjo X-ray 3.3 B 9-87 None
3cw1 X-ray 5.49 A 9-81 None
3cw1 X-ray 5.49 H 209-281 None
3cw1 X-ray 5.49 I 410-481 None
3cw1 X-ray 5.49 J 609-681 None
3jcr X-ray 7 o 9-81 None
3jcr X-ray 7 O 9-81 None
5o9z X-ray 4.5 X 32-81 None
5o9z X-ray 4.5 m 9-81 None
5o9z X-ray 4.5 f 9-81 None


© NPIDB team 2003 - 2019

text