Pfam domain
Pfam family: Rad4 (PF03835.14)
Uniprot AC: P14736
RecName: DNA repair protein RAD4
Begin-End: 284-426
Organism: Saccharomyces cerevisiae
Interaction Mode:  S-Bb L-Bb 

Sequence:
MSCQPPDFTNMKIDTSLNGNNAYKDMVKYPIFWCEVWDKFSKKWITVDPVNLKTIEQVRL
HSKLAPKGVACCERNMLRYVIAYDRKYGCRDVTRRYAQWMNSKVRKRRITKDDFGEKWFR
KVITALHHRKRTKIDDYEDQYFF
Structures of the domain P14736 284-426
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2qsg X-ray 3.1 A 285-425  S-Bb L-Bb 
2qsh X-ray 2.81 A 285-425  L-Bb 
4yir X-ray 3.05 A 285-425 None


© NPIDB team 2003 - 2019

text