Pfam domain
Pfam family: Ribosomal_L40e (PF01020.16)
Uniprot AC: P14794
RecName: Ubiquitin-60S ribosomal protein L40
Begin-End: 77-126
Organism: Dictyostelium discoideum
Interaction Mode:   

Sequence:
IEPSLVILARKYKCDKMICRKCYARLHPRAVNCRKKKCGHSNNLRPKKKL
Structures of the domain P14794 77-126
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5anb X-ray 4.1 H 1-50 None
5anc X-ray 4.2 H 1-50 None
5an9 X-ray 3.3 H 1-50 None


© NPIDB team 2003 - 2019

text