Pfam domain
Pfam family: Pou (PF00157.16)
Uniprot AC: P14859
RecName: POU domain, class 2, transcription factor 1
Begin-End: 283-354
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
SDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKL
KPLLEKWLNDAE
Structures of the domain P14859 283-354
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1cqt X-ray 3.2 A 5-75  H-Bb H-Mj L-Bb L-Mj 
1cqt X-ray 3.2 B 506-575  H-Bb H-Mj S-Bb L-Bb L-Mj 
1o4x NMR A 9-79  H-Bb H-Mj L-Bb 
1oct X-ray 3 C 6-75  H-Bb H-Mj L-Bb L-Mj 
1hf0 X-ray 2.7 B 6-75  H-Bb H-Mj L-Bb 
1hf0 X-ray 2.7 A 6-75  H-Bb H-Mj L-Bb L-Mj 
1gt0 X-ray 2.6 C 5-75  H-Bb H-Mj L-Bb 
1e3o X-ray 1.9 C 5-75  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2019

text