Pfam domain
Pfam family: FokI_N (PF02981.14)
Uniprot AC: P14870
RecName: Type-2 restriction enzyme FokI
Begin-End: 10-145
Organism: Planomicrobium okeanokoites
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj L-Mn 

Sequence:
RTFGWVQNPGKFENLKRVVQVFDRNSKVHNEVKNIKIPTLVKESKIQKELVAIMNQHDLI
YTYKELVGTGTSIRSEAPCDAIIQATIADQGNKKGYIDNWSSDGFLRWAHALGFIEYINK
SDSFVITDVGLAYSKS
Structures of the domain P14870 10-145
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1fok X-ray 2.8 A 6-140  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2019

text