Pfam domain
Pfam family: FokI_C (PF02980.15)
Uniprot AC: P14870
RecName: Type-2 restriction enzyme FokI
Begin-End: 152-285
Organism: Planomicrobium okeanokoites
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
EKEILIEAISSYPPAIRILTLLEDGQHLTKFDLGKNLGFSGESGFTSLPEGILLDTLANA
MPKDKGEIRNNWEGSSDKYARMIGGWLDKLGLVKQGKKEFIIPTLGKPDNKEFISHAFKI
TGEGLKVLRRAKGS
Structures of the domain P14870 152-285
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1fok X-ray 2.8 A 148-280  H-Bb H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2019

text