Pfam domain
Pfam family: Type2_restr_D3 (PF16902.4)
Uniprot AC: P14870
RecName: Type-2 restriction enzyme FokI
Begin-End: 300-367
Organism: Planomicrobium okeanokoites
Interaction Mode:  H-Bb L-Bb 

Sequence:
LATNLTDKEYVRTRRALILEILIKAGSLKIEQIQDNLKKLGFDEVIETIENDIKGLINTG
IFIEIKGR
Structures of the domain P14870 300-367
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1fok X-ray 2.8 A 296-362  H-Bb L-Bb 


© NPIDB team 2003 - 2019

text