Pfam domain
Pfam family: Endonuc-FokI_C (PF09254.10)
Uniprot AC: P14870
RecName: Type-2 restriction enzyme FokI
Begin-End: 391-580
Organism: Planomicrobium okeanokoites
Interaction Mode:  H-Bb 

Sequence:
KSELEEKKSELRHKLKYVPHEYIELIEIARNSTQDRILEMKVMEFFMKVYGYRGKHLGGS
RKPDGAIYTVGSPIDYGVIVDTKAYSGGYNLPIGQADEMQRYVEENQTRNKHINPNEWWK
VYPSSVTEFKFLFVSGHFKGNYKAQLTRLNHITNCNGAVLSVEELLIGGEMIKAGTLTLE
EVRRKFNNGE
Structures of the domain P14870 391-580
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1fok X-ray 2.8 A 387-574  H-Bb 


© NPIDB team 2003 - 2019

text