Pfam domain
Pfam family: Ets (PF00178.21)
Uniprot AC: P14921
RecName: Protein C-ets-1
Begin-End: 336-415
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
QLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRY
YYDKNIIHKTAGKRYVYRFV
Structures of the domain P14921 336-415
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2stt NMR A 26-105  H-Mj 
3mfk X-ray 3 A 336-415  H-Bb H-Mj S-Bb L-Bb 
3mfk X-ray 3 B 336-415  H-Bb H-Mj L-Bb 
3wtw X-ray 2.9 H 336-415  H-Bb H-Mj S-Bb L-Bb L-Mj 
3wtw X-ray 2.9 C 336-415 None
2stw NMR A 26-105  H-Bb H-Mj 
2nny X-ray 2.58 A 336-415  H-Bb H-Mj L-Bb 
2nny X-ray 2.58 B 336-415  H-Bb H-Mj L-Bb 
3wtu X-ray 2.7 C 336-415  H-Bb H-Mj S-Bb L-Bb 
3wtu X-ray 2.7 H 336-415 None
3wu1 X-ray 2.4 B 336-415  H-Bb H-Mj L-Bb 
4l0z X-ray 2.7 B 336-415  H-Bb H-Mj L-Bb 
4lg0 X-ray 2.19 B 336-415  H-Bb H-Mj L-Bb 
4l0y X-ray 2.5 B 336-415  H-Bb H-Mj L-Bb 
4l18 X-ray 2.3 F 336-415  H-Bb H-Mj S-Bb L-Bb 
4l18 X-ray 2.3 B 336-415 None
3ri4 X-ray 3 A 336-415  H-Bb H-Mj L-Bb 
3ri4 X-ray 3 D 336-415  H-Bb H-Mj L-Bb 
3wtv X-ray 2.7 C 336-415  H-Bb H-Mj S-Bb L-Bb 
3wtv X-ray 2.7 H 336-415 None
3wtx X-ray 2.8 C 336-415  H-Bb H-Mj S-Bb L-Bb 
3wtx X-ray 2.8 H 336-415  H-Bb H-Mj S-Bb L-Bb 
3wts X-ray 2.35 C 336-415  H-Bb H-Mj S-Bb L-Bb 
3wts X-ray 2.35 H 336-415 None
3wty X-ray 2.7 C 336-415  H-Bb H-Mj S-Bb L-Bb 
3wty X-ray 2.7 H 336-415  H-Bb H-Mj S-Bb 


© NPIDB team 2003 - 2019

text