Pfam domain
Pfam family: MrcB_N (PF12102.10)
Uniprot AC: P15005
RecName: 5-methylcytosine-specific restriction enzyme B
Begin-End: 3-131
Organism: Escherichia coli
Interaction Mode:  S-Bb L-Bb L-Mj L-Mn 

Sequence:
SIQPWIEKFIKQAQQQRSQSTKDYPTSYRNLRVKLSFGYGNFTSIPWFAFLGEGQEASNG
IYPVILYYKDFDELVLAYGISDTNEPHAQWQFSSDIPKTIAEYFQATSGVYPKKYGQSYY
ACSQKVSQG
Structures of the domain P15005 3-131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gcd X-ray 1.8 A 3-136  S-Bb L-Bb L-Mj L-Mn 
6gcd X-ray 1.8 B 3-136  S-Bb L-Bb L-Mj L-Mn 
6gce X-ray 1.6 A 3-135  S-Bb L-Bb L-Mj L-Mn 
6gce X-ray 1.6 B 3-135  S-Bb L-Bb L-Mj L-Mn 
6gcf X-ray 1.55 B 5-135  S-Bb L-Bb L-Mj L-Mn 
6gcf X-ray 1.55 A 4-135  S-Bb L-Bb L-Mj L-Mn 
3sse X-ray 2.7 B 5-135  S-Bb L-Bb L-Mj L-Mn 
3sse X-ray 2.7 A 5-135  S-Bb L-Bb L-Mj L-Mn 
3ssd X-ray 2.2 A 4-135  S-Bb L-Bb L-Mj L-Mn 
3ssd X-ray 2.2 B 5-135  S-Bb L-Bb L-Mj L-Mn 
3ssc X-ray 2.1 B 3-135  S-Bb L-Bb L-Mj L-Mn 
3ssc X-ray 2.1 A 4-135  S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text