Pfam domain
Pfam family: Ets (PF00178.21)
Uniprot AC: P15036
RecName: Protein C-ets-2
Begin-End: 364-443
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
QLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGLRY
YYDKNIIHKTSGKRYVYRFV
Structures of the domain P15036 364-443
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4bqa X-ray 2.5 D 364-443  H-Bb H-Mj L-Bb 
4bqa X-ray 2.5 G 364-443 None
4bqa X-ray 2.5 A 364-443 None


© NPIDB team 2003 - 2019

text