Pfam domain
Pfam family: GTP_EFTU_D2 (PF03144.24)
Uniprot AC: P15170
RecName: Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
Begin-End: 314-381
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEE
ILPGFILC
Structures of the domain P15170 314-381
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d61 X-ray 9 i 443-510 None
3j5y X-ray 9.7 B 452-519 None


© NPIDB team 2003 - 2019

text