Pfam domain
Pfam family: GTP_EFTU_D3 (PF03143.16)
Uniprot AC: P15170
RecName: Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
Begin-End: 387-495
Organism: Homo sapiens
Interaction Mode:   

Sequence:
CHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRF
VKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLV
Structures of the domain P15170 387-495
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d61 X-ray 9 i 520-623 None
3j5y X-ray 9.7 B 529-632 None


© NPIDB team 2003 - 2019

text