Pfam domain
Pfam family: GTP_EFTU (PF00009.26)
Uniprot AC: P15170
RecName: Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
Begin-End: 72-350
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQ
EERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFE
TGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFN
PKKDIHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDGPIRLPIVDKYK
DMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDD
Structures of the domain P15170 72-350
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d61 X-ray 9 i 201-400 None
3j5y X-ray 9.7 B 210-409 None


© NPIDB team 2003 - 2019

text