Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: P15207
RecName: Androgen receptor
Begin-End: 540-609
Organism: Rattus norvegicus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
KTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRL
RKCYEAGMTL
Structures of the domain P15207 540-609
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1r4i X-ray 3.1 B 540-608  H-Bb H-Mj S-Bb L-Bb L-Mj 
1r4i X-ray 3.1 A 540-608  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text