Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.18)
Uniprot AC: P15436
RecName: DNA polymerase delta catalytic subunit
Begin-End: 142-482
Organism: Saccharomyces cerevisiae
Interaction Mode:  L-Mj 

Sequence:
VTSEGHSVLCNVTGFKNYLYVPAPNSSDANDQEQINKFVHYLNETFDHAIDSIEVVSKQS
IWGYSGDTKLPFWKIYVTYPHMVNKLRTAFERGHLSFNSWFSNGTTTYDNIAYTLRLMVD
CGIVGMSWITLPKGKYSMIEPNNRVSSCQLEVSINYRNLIAHPAEGDWSHTAPLRIMSFD
IECAGRIGVFPEPEYDPVIQIANVVSIAGAKKPFIRNVFTLNTCSPITGSMIFSHATEEE
MLSNWRNFIIKVDPDVIIGYNTTNFDIPYLLNRAKALKVNDFPYFGRLKTVKQEIKESVF
SSKAYGTRETKNVNIDGRLQLDLLQFIQREYKLRSYTLNAV
Structures of the domain P15436 142-482
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3iay X-ray 2 A 143-482  L-Mj 


© NPIDB team 2003 - 2020

text