Pfam domain
Pfam family: DNA_pol_B (PF00136.23)
Uniprot AC: P15436
RecName: DNA polymerase delta catalytic subunit
Begin-End: 546-973
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mj L-Mn 

Sequence:
VPFSYLLARGQQIKVVSQLFRKCLEIDTVIPNMQSQASDDQYEGATVIEPIRGYYDVPIA
TLDFNSLYPSIMMAHNLCYTTLCNKATVERLNLKIDEDYVITPNGDYFVTTKRRRGILPI
ILDELISARKRAKKDLRDEKDPFKRDVLNGRQLALKISANSVYGFTGATVGKLPCLAISS
SVTAYGRTMILKTKTAVQEKYCIKNGYKHDAVVVYGDTDSVMVKFGTTDLKEAMDLGTEA
AKYVSTLFKHPINLEFEKAYFPYLLINKKRYAGLFWTNPDKFDKLDQKGLASVRRDSCSL
VSIVMNKVLKKILIERNVDGALAFVRETINDILHNRVDISKLIISKTLAPNYTNPQPHAV
LAERMKRREGVGPNVGDRVDYVIIGGNDKLYNRAEDPLFVLENNIQVDSRYYLTNQLQNP
IISIVAPI
Structures of the domain P15436 546-973
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6p1h X-ray 3.2 A 546-973  H-Bb H-Mn S-Bb L-Bb L-Mn 
3iay X-ray 2 A 546-973  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text