Pfam domain
Pfam family: DNA_pol_B (PF00136.20)
Uniprot AC: P15436
RecName: DNA polymerase delta catalytic subunit
Begin-End: 546-973
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
VPFSYLLARGQQIKVVSQLFRKCLEIDTVIPNMQSQASDDQYEGATVIEPIRGYYDVPIA
TLDFNSLYPSIMMAHNLCYTTLCNKATVERLNLKIDEDYVITPNGDYFVTTKRRRGILPI
ILDELISARKRAKKDLRDEKDPFKRDVLNGRQLALKISANSVYGFTGATVGKLPCLAISS
SVTAYGRTMILKTKTAVQEKYCIKNGYKHDAVVVYGDTDSVMVKFGTTDLKEAMDLGTEA
AKYVSTLFKHPINLEFEKAYFPYLLINKKRYAGLFWTNPDKFDKLDQKGLASVRRDSCSL
VSIVMNKVLKKILIERNVDGALAFVRETINDILHNRVDISKLIISKTLAPNYTNPQPHAV
LAERMKRREGVGPNVGDRVDYVIIGGNDKLYNRAEDPLFVLENNIQVDSRYYLTNQLQNP
IISIVAPI
Structures of the domain P15436 546-973
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3iay X-ray 2 A 540-973  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text