Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.18)
Uniprot AC: P15563
RecName: Uncharacterized 49.1 kDa protein in ND3 intron
Begin-End: 147-246
Organism: Podospora anserina
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
ISGFVDGEGSFMLTIIKDNKYKLGWRVVCRFVISLHKKDLSLLNKIKEFFDVGNVFLMTK
DSAQYRVESLKGLDLIINHFDKYPLITKKQADYKLFKMAH
Structures of the domain P15563 147-246
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5esp X-ray 3 A 13-111  H-Bb S-Bb S-Mj L-Bb L-Mj 
5esp X-ray 3 B 13-111  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2020

text