Pfam domain
Pfam family: Ribosomal_L10 (PF00466.19)
Uniprot AC: P15825
RecName: 50S ribosomal protein L10
Begin-End: 11-109
Organism: Haloarcula marismortui
Interaction Mode:   

Sequence:
TIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERA
LDDVDDGLEDLNGYITGQVGLIGTDDNPFSLFQELEASK
Structures of the domain P15825 11-109
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2qa4 X-ray 3 G 13-107 None


© NPIDB team 2003 - 2019

text