Pfam domain
Pfam family: Ribosomal_S5 (PF00333.19)
Uniprot AC: P15880
RecName: 40S ribosomal protein S2
Begin-End: 102-166
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLS
IVPVR
Structures of the domain P15880 102-166
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 C 102-166 None
5flx X-ray 3.9 C 102-166 None
5oa3 X-ray 4.3 C 102-166 None


© NPIDB team 2003 - 2020

text