Pfam domain
Pfam family: RAG1 (PF12940.6)
Uniprot AC: P15919
RecName: V(D)J recombination-activating protein 1
Begin-End: 385-1007
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
HINKGGRPRQHLLSLTRRAQKHRLRELKIQVKEFADKEEGGDVKAVCLTLFLLALRARNE
HRQADELEAIMQGRGSGLQPAVCLAIRVNTFLSCSQYHKMYRTVKAITGRQIFQPLHALR
NAEKVLLPGYHPFEWQPPLKNVSSRTDVGIIDGLSGLASSVDEYPVDTIAKRFRYDSALV
SALMDMEEDILEGMRSQDLDDYLNGPFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSF
TVMRITIEHGSQNVKVFEEPKPNSELCCKPLCLMLADESDHETLTAILSPLIAEREAMKS
SELTLEMGGIPRTFKFIFRGTGYDEKLVREVEGLEASGSVYICTLCDTTRLEASQNLVFH
SITRSHAENLQRYEVWRSNPYHESVEELRDRVKGVSAKPFIETVPSIDALHCDIGNAAEF
YKIFQLEIGEVYKHPNASKEERKRWQATLDKHLRKRMNLKPIMRMNGNFARKLMTQETVD
AVCELIPSEERHEALRELMDLYLKMKPVWRSSCPAKECPESLCQYSFNSQRFAELLSTKF
KYRYEGKITNYFHKTLAHVPEIIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEM
EDVLKHHWLYTSKYLQKFMNAHN
Structures of the domain P15919 385-1007
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ze0 X-ray 2.75 C 386-1006  H-Bb H-Mj L-Bb L-Mn 
5zdz X-ray 2.8 C 386-1006  H-Bb H-Mj L-Bb L-Mn 
5ze2 X-ray 3.3 C 386-1006 None
5ze1 X-ray 3 C 386-1006  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2020

text