Pfam domain
Pfam family: RAG1 (PF12940.6)
Uniprot AC: P15919
RecName: V(D)J recombination-activating protein 1
Begin-End: 389-456
Organism: Mus musculus
Interaction Mode:   

Sequence:
GGRPRQHLLSLTRRAQKHRLRELKIQVKEFADKEEGGDVKAVCLTLFLLALRARNEHRQA
DELEAIMQ
Structures of the domain P15919 389-456
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3gnb X-ray 3 A 389-456 None
3gna X-ray 2.4 A 389-456 None


© NPIDB team 2003 - 2020

text