Pfam domain
Pfam family: RAG1 (PF12940.9)
Uniprot AC: P15919
RecName: V(D)J recombination-activating protein 1
Begin-End: 401-1008
Organism: Mus musculus
Interaction Mode:   

Sequence:
RRAQKHRLRELKIQVKEFADKEEGGDVKAVCLTLFLLALRARNEHRQADELEAIMQGRGS
GLQPAVCLAIRVNTFLSCSQYHKMYRTVKAITGRQIFQPLHALRNAEKVLLPGYHPFEWQ
PPLKNVSSRTDVGIIDGLSGLASSVDEYPVDTIAKRFRYDSALVSALMDMEEDILEGMRS
QDLDDYLNGPFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTVMRITIEHGSQNVKV
FEEPKPNSELCCKPLCLMLADESDHETLTAILSPLIAEREAMKSSELTLEMGGIPRTFKF
IFRGTGYDEKLVREVEGLEASGSVYICTLCDTTRLEASQNLVFHSITRSHAENLQRYEVW
RSNPYHESVEELRDRVKGVSAKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKHPN
ASKEERKRWQATLDKHLRKRMNLKPIMRMNGNFARKLMTQETVDAVCELIPSEERHEALR
ELMDLYLKMKPVWRSSCPAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTL
AHVPEIIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYTSKYLQ
KFMNAHNA
Structures of the domain P15919 401-1008
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6oep X-ray 3.7 A 401-1008  H-Bb H-Mj L-Bb L-Mj 
6oeo X-ray 3.69 A 401-1008  H-Bb H-Mj L-Bb L-Mj 
6oer X-ray 3.29 A 401-1008  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text