Pfam domain
Pfam family: RAG1 (PF12940.9)
Uniprot AC: P15919
RecName: V(D)J recombination-activating protein 1
Begin-End: 461-1007
Organism: Mus musculus
Interaction Mode:   

Sequence:
GLQPAVCLAIRVNTFLSCSQYHKMYRTVKAITGRQIFQPLHALRNAEKVLLPGYHPFEWQ
PPLKNVSSRTDVGIIDGLSGLASSVDEYPVDTIAKRFRYDSALVSALMDMEEDILEGMRS
QDLDDYLNGPFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTVMRITIEHGSQNVKV
FEEPKPNSELCCKPLCLMLADESDHETLTAILSPLIAEREAMKSSELTLEMGGIPRTFKF
IFRGTGYDEKLVREVEGLEASGSVYICTLCDTTRLEASQNLVFHSITRSHAENLQRYEVW
RSNPYHESVEELRDRVKGVSAKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKHPN
ASKEERKRWQATLDKHLRKRMNLKPIMRMNGNFARKLMTQETVDAVCELIPSEERHEALR
ELMDLYLKMKPVWRSSCPAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTL
AHVPEIIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYTSKYLQ
KFMNAHN
Structures of the domain P15919 461-1007
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xny X-ray 2.9 A 459-1008  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
6xny X-ray 2.9 C 460-1007  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
6v0v X-ray 3.61 A 461-1008  H-Bb S-Bb L-Bb L-Mj L-Mn 
6oes X-ray 3.06 C 461-1007  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
6oes X-ray 3.06 A 461-1008  H-Bb H-Mj H-Mn L-Bb L-Mn 
6xnx X-ray 2.7 C 460-1007  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
6xnx X-ray 2.7 A 460-1008  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
6xnz X-ray 3.8 A 459-1008  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
6xnz X-ray 3.8 C 459-1007  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text