Pfam domain
Pfam family: HTH_3 (PF01381.21)
Uniprot AC: P16117
RecName: Repressor protein CI (Fragment)
Begin-End: 7-60
Organism: Enterobacteria phage 434
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
VKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWL
Structures of the domain P16117 7-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1rpe X-ray 2.5 R 6-59  H-Bb H-Mj L-Bb L-Mj 
1rpe X-ray 2.5 L 6-59  H-Bb H-Mj L-Bb L-Mj 
2or1 X-ray 2.5 L 6-59  H-Bb H-Mj L-Bb L-Mj 
2or1 X-ray 2.5 R 6-59  H-Bb H-Mj L-Bb L-Mj 
1per X-ray 2.5 R 6-59  H-Bb H-Mj L-Bb L-Mj 
1per X-ray 2.5 L 6-59  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2020

text