Pfam domain
Pfam family: RHD_DNA_bind (PF00554.21)
Uniprot AC: P16236
RecName: Proto-oncogene c-Rel
Begin-End: 9-177
Organism: Gallus gallus
Interaction Mode:  H-Bb H-Mj S-Mj L-Bb L-Mj 

Sequence:
IEIFEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNKTFPSIQILNYFGKVKIRTTLVTKN
EPYKPHPHDLVGKDCRDGYYEAEFGPERRVLSFQNLGIQCVKKKDLKESISLRISKKINP
FNVPEEQLHNIDEYDLNVVRLCFQAFLPDEHGNYTLALPPLISNPIYDN
Structures of the domain P16236 9-177
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1gji X-ray 2.85 A 9-177  H-Bb L-Bb L-Mj 
1gji X-ray 2.85 B 9-177  H-Bb H-Mj S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text