Pfam domain
Pfam family: DNA_binding_1 (PF01035.19)
Uniprot AC: P16455
RecName: Methylated-DNA--protein-cysteine methyltransferase
Begin-End: 93-174
Organism: Homo sapiens
Interaction Mode:   

Sequence:
SFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSS
GAVGNYSGGLAVKEWLLAHEGH
Structures of the domain P16455 93-174
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1yfh X-ray 3.01 C 95-173 None
1yfh X-ray 3.01 A 95-173 None
1yfh X-ray 3.01 B 95-173 None
1t39 X-ray 3.3 A 95-173 None
1t39 X-ray 3.3 B 95-173 None
1t38 X-ray 3.2 A 95-173 None


© NPIDB team 2003 - 2019

text