Pfam domain
Pfam family: Phi-29_GP16_7 (PF06720.10)
Uniprot AC: P16517
RecName: DNA replication protein 16.7
Begin-End: 67-130
Organism: Bacillus phage phi29
Interaction Mode:   

Sequence:
NLSACEVAVLDLYEQSNIRIPSDIIEDLVNQRLQSEQEVLNYIETQRTYWKLENQKKLYR
GSLK
Structures of the domain P16517 67-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2c5r X-ray 2.9 F 66-128 None
2c5r X-ray 2.9 E 66-128 None
2c5r X-ray 2.9 D 66-128 None
2c5r X-ray 2.9 C 66-128 None
2c5r X-ray 2.9 B 66-128 None
2c5r X-ray 2.9 A 66-128 None


© NPIDB team 2003 - 2019

text