Pfam domain
Pfam family: Ribosomal_L7Ae (PF01248.25)
Uniprot AC: P17076
RecName: 60S ribosomal protein L8-A
Begin-End: 117-212
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
AEGKSKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIELVVFLPALCKKMGVP
YAIVKGKARLGTLVNQKTSAVAALTEVRAEDEAALA
Structures of the domain P17076 117-212
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 G 127-207 None
6em3 X-ray 3.2 G 127-207 None
6em5 X-ray 4.3 G 127-207 None


© NPIDB team 2003 - 2019

text