Pfam domain
Pfam family: Ribosomal_S7 (PF00177.20)
Uniprot AC: P17291
RecName: 30S ribosomal protein S7
Begin-End: 12-146
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
LQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKP
RMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGK
GGAVKKKEDVERMAE
Structures of the domain P17291 12-146
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1eg0 X-ray 11.5 D 2-135 None


© NPIDB team 2003 - 2019

text