Pfam domain
Pfam family: GATA (PF00320.26)
Uniprot AC: P17429
RecName: Nitrogen regulatory protein areA
Begin-End: 673-707
Organism: Emericella nidulans
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
CTNCFTQTTPLWRRNPEGQPLCNACGLFLKLHGVV
Structures of the domain P17429 673-707
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4gat NMR A 12-45  H-Bb H-Mj S-Mj L-Bb L-Mj 
6gat NMR A 12-45  H-Bb H-Mj S-Mj L-Bb L-Mj 
7gat NMR A 12-45  H-Bb H-Mj L-Bb L-Mj 
5gat NMR A 12-45  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text