Pfam domain
Pfam family: Ets (PF00178.21)
Uniprot AC: P17433
RecName: Transcription factor PU.1
Begin-End: 173-255
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
RLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMAR
ALRNYGKTGEVKKVKKKLTYQFS
Structures of the domain P17433 173-255
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1pue X-ray 2.1 F 173-254  H-Bb H-Mj L-Bb 
1pue X-ray 2.1 E 173-254 None


© NPIDB team 2003 - 2019

text