Pfam domain
Pfam family: Parvo_coat (PF00740.17)
Uniprot AC: P17455
RecName: Capsid protein VP1
Begin-End: 172-706
Organism: Canine parvovirustype 2 (isolate Dog/United States/CPV-d/1988)
Interaction Mode:   

Sequence:
GGGGGGSGGVGISTGTFNNQTEFKFLENGWVEITANSSRLVHLNMPESENYRRVVVNNMD
KTAVNGNMALDDIHAQIVTPWSLVDANAWGVWFNPGDWQLIVNTMSELHLVSFEQEIFNV
VLKTVSESATQPPTKVYNNDLTASLMVALDSNNTMPFTPAAMRSETLGFYPWKPTIPTPW
RYYFQWDRTLIPSHTGTSGTPTNIYHGTDPDDVQFYTIENSVPVHLLRTGDEFATGTFFF
DCKPCRLTHTWQTNRALGLPPFLNSLPQSEGATNFGDIGVQQDKRRGVTQMGNTNYITEA
TIMRPAEVGYSAPYYSFEASTQGPFKTPIAAGRGGAQTDENQAADGNPRYAFGRQHGQKT
TTTGETPERFTYIAHQDTGRYPEGDWIQNINFNLPVTNDNVLLPTDPIGGKTGINYTNIF
NTYGPLTALNNVPPVYPNGQIWDKEFDTDLKPRLHVNAPFVCQNNCPGQLFVKVAPNLTN
EYDPDASANMSRIVTYSDFWWKGKLVFKAKLRASHTWNPIQQMSINVDNQFNYVP
Structures of the domain P17455 172-706
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4dpv X-ray 2.9 Z 30-553 None


© NPIDB team 2003 - 2019

text