Pfam domain
Pfam family: bZIP_2 (PF07716.14)
Uniprot AC: P17676
RecName: CCAAT/enhancer-binding protein beta
Begin-End: 270-323
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj 

Sequence:
HSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRE
Structures of the domain P17676 270-323
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1gu4 X-ray 1.8 A 270-323  H-Bb H-Mj 
1gu4 X-ray 1.8 B 270-323  H-Bb H-Mj 
1gu5 X-ray 2.1 A 270-323  H-Bb H-Mj 
1gu5 X-ray 2.1 B 270-323  H-Bb H-Mj 
2e43 X-ray 2.1 A 271-323  H-Bb H-Mj 
2e43 X-ray 2.1 B 271-323  H-Bb H-Mj 
2e42 X-ray 1.8 A 270-323  H-Bb H-Mj 
2e42 X-ray 1.8 B 270-323  H-Bb H-Mj 
1h8a X-ray 2.23 A 270-323  H-Bb H-Mj 
1h8a X-ray 2.23 B 270-323  H-Bb H-Mj 
1gtw X-ray 1.85 B 270-323  H-Bb H-Mj 
1gtw X-ray 1.85 A 270-323  H-Bb H-Mj 
1gtw X-ray 1.85 A 270-323  H-Bb H-Mj 
1gtw X-ray 1.85 B 270-323  H-Bb H-Mj 
1hjb X-ray 3 B 270-323  H-Bb H-Mj 
1hjb X-ray 3 A 270-323  H-Bb H-Mj 
1hjb X-ray 3 E 270-323  H-Bb H-Mj 
1hjb X-ray 3 D 270-323  H-Bb H-Mj 
1io4 X-ray 3 A 270-323  H-Bb H-Mj 
1io4 X-ray 3 B 270-323  H-Bb H-Mj 


© NPIDB team 2003 - 2020

text