Pfam domain
Pfam family: GATA (PF00320.26)
Uniprot AC: P17678
RecName: Erythroid transcription factor
Begin-End: 164-198
Organism: Gallus gallus
Interaction Mode:  H-Bb H-Mj S-Mj L-Bb L-Mj L-Mn 

Sequence:
CSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVN
Structures of the domain P17678 164-198
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3gat NMR A 7-40  H-Bb H-Mj S-Mj L-Bb L-Mj L-Mn 
1gau NMR A 7-40 None
2gat NMR A 7-40  H-Bb H-Mj L-Bb L-Mj L-Mn 
1gat NMR A 7-40 None


© NPIDB team 2003 - 2019

text