Pfam domain
Pfam family: GATA (PF00320.26)
Uniprot AC: P17679
RecName: Erythroid transcription factor
Begin-End: 204-238
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
CVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQN
Structures of the domain P17679 204-238
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3vd6 X-ray 1.98 C 204-237  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
3vek X-ray 2.63 F 204-237  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
3vek X-ray 2.63 C 204-237 None


© NPIDB team 2003 - 2019

text