Pfam domain
Pfam family: Endonuc-HincII (PF09226.10)
Uniprot AC: P17743
RecName: Type-2 restriction enzyme HincII
Begin-End: 11-257
Organism: Haemophilus influenzae
Interaction Mode:  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 

Sequence:
INSILIGQKVKRPKSGTLSGHAAGEPFEKLVYKFLKENLSDLTFKQYEYLNDLFMKNPAI
IGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEKQNDTADILLVKDQFYELLDVKR
RNISKSAQAPNIISAYKLAQTCAKMIDNKEFDLFDINYLEVDSELNGEDLVCVSTSFAEL
FKSEPSELYINWAAAMQIQFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFV
KPFKKYI
Structures of the domain P17743 11-257
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3e41 X-ray 2.73 A 12-257  S-Bb S-Mj L-Bb L-Mj L-Mn 
3e41 X-ray 2.73 B 12-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2gih X-ray 2.5 A 11-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2gih X-ray 2.5 B 11-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
3e43 X-ray 2.73 A 11-257  S-Bb S-Mj L-Bb L-Mj L-Mn 
3e43 X-ray 2.73 B 19-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2gij X-ray 1.93 A 20-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2gij X-ray 1.93 B 18-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
3e42 X-ray 2.68 A 11-257  S-Bb S-Mj L-Bb L-Mj L-Mn 
3e42 X-ray 2.68 B 19-257  S-Bb S-Mj L-Bb L-Mj L-Mn 
1tx3 X-ray 2.5 A 11-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1tx3 X-ray 2.5 B 11-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1tx3 X-ray 2.5 C 11-257 None
1tx3 X-ray 2.5 D 20-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1tx3 X-ray 2.5 C 11-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1kc6 X-ray 2.6 A 11-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1kc6 X-ray 2.6 B 15-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1kc6 X-ray 2.6 D 19-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1kc6 X-ray 2.6 C 21-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2gii X-ray 2.3 A 19-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2gii X-ray 2.3 B 35-256  S-Bb S-Mj L-Bb L-Mj L-Mn 
3e45 X-ray 2.78 A 22-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
3e45 X-ray 2.78 B 12-257  S-Bb S-Mj L-Bb L-Mj L-Mn 
3e44 X-ray 2.52 A 15-257 None
3e44 X-ray 2.52 B 20-257 None
3e40 X-ray 2.1 A 22-257  S-Bb S-Mj L-Bb L-Mj L-Mn 
3e40 X-ray 2.1 B 38-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
3e3y X-ray 2.13 A 21-257  S-Bb S-Mj L-Bb L-Mj L-Mn 
3e3y X-ray 2.13 B 21-257  S-Bb S-Mj L-Bb L-Mj L-Mn 
2gie X-ray 2.6 A 11-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2gie X-ray 2.6 B 11-257  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 
2gie X-ray 2.6 D 11-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2gie X-ray 2.6 C 11-257  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 
2gig X-ray 1.83 A 11-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2gig X-ray 1.83 B 19-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1xhv X-ray 2.5 A 11-257 None
1xhv X-ray 2.5 B 11-257 None
1xhv X-ray 2.5 D 15-257 None
1xhv X-ray 2.5 C 11-257 None
3ebc X-ray 2.55 A 12-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
3ebc X-ray 2.55 B 21-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1xhu X-ray 2.95 A 11-257 None
1xhu X-ray 2.95 B 11-257 None
1xhu X-ray 2.95 D 11-257 None
1xhu X-ray 2.95 C 11-257 None
1tw8 X-ray 2.8 A 11-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1tw8 X-ray 2.8 B 11-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1tw8 X-ray 2.8 D 11-256  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1tw8 X-ray 2.8 C 11-257  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2019

text