Pfam domain
Pfam family: DEAD_2 (PF06733.14)
Uniprot AC: P18074
RecName: General transcription and DNA repair factor IIH helicase subunit XPD
Begin-End: 72-256
Organism: Homo sapiens
Interaction Mode:   

Sequence:
YCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVD
GKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCP
YFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNL
TRRTL
Structures of the domain P18074 72-256
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 W 72-256 None
5iy8 X-ray 7.9 W 72-256 None
5ivw X-ray 10 W 72-256 None
5iy6 X-ray 7.2 W 72-256 None
5iy9 X-ray 6.3 W 72-256 None


© NPIDB team 2003 - 2019

text