Pfam domain
Pfam family: DNA_ligase_A_N (PF04675.16)
Uniprot AC: P18858
RecName: DNA ligase 1
Begin-End: 288-464
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mn L-Bb 

Sequence:
PYLAVARTFEKIEEVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLEL
GVGDGVLLKAVAQATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSK
FRDIARLTGSASTAKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALS
Structures of the domain P18858 288-464
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1x9n X-ray 3 A 288-464  H-Bb L-Bb L-Mn 
6p0e X-ray 1.85 A 288-464  H-Bb H-Mn L-Bb 
6p0d X-ray 1.75 A 288-464  H-Bb H-Mn L-Bb 
6p0c X-ray 1.55 A 288-464  H-Bb H-Mn L-Bb 
6p0b X-ray 2.2 A 288-464  H-Bb H-Mn L-Bb 
6p0a X-ray 2.05 A 288-464  H-Bb L-Bb 
6p09 X-ray 2.05 A 288-464  H-Bb H-Mn L-Bb 
6q1v X-ray 1.85 A 288-464  H-Bb H-Mn L-Bb 


© NPIDB team 2003 - 2021

text