Pfam domain
Pfam family: DNA_ligase_A_C (PF04679.17)
Uniprot AC: P18858
RecName: DNA ligase 1
Begin-End: 771-882
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mn 

Sequence:
RAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAV
IPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDK
Structures of the domain P18858 771-882
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1x9n X-ray 3 A 771-882  H-Bb S-Bb L-Bb L-Mn 
6p0e X-ray 1.85 A 771-882  H-Bb H-Mn S-Bb L-Bb L-Mn 
6p0d X-ray 1.75 A 771-882  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mn 
6p0c X-ray 1.55 A 771-882  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mn 
6p0b X-ray 2.2 A 771-882  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mn 
6p0a X-ray 2.05 A 771-882  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mn 
6p09 X-ray 2.05 A 771-882  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mn 
6q1v X-ray 1.85 A 771-882  H-Bb H-Mn S-Bb S-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2021

text