Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.25)
Uniprot AC: P19387
RecName: DNA-directed RNA polymerase II subunit RPB3
Begin-End: 50-177
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VQIDANSSVLHDEFIAHRLGLIPLISDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNE
DQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGF
GKEHAKWN
Structures of the domain P19387 50-177
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 C 50-177 None
5iya X-ray 5.4 C 50-177 None
5iy8 X-ray 7.9 C 50-177 None
5iyd X-ray 3.9 C 50-177 None
5iy6 X-ray 7.2 C 50-177 None
5iyc X-ray 3.9 C 50-177 None
5iy9 X-ray 6.3 C 50-177 None
5iyb X-ray 3.9 C 50-177 None


© NPIDB team 2003 - 2019

text